- FAM207A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90676
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- FAM207A
- This antibody was developed against Recombinant Protein corresponding to amino acids: AFINTNIFAR TKIDPSALVQ KLELDVRSVT SVRRGEAGSS ARSVPSIRRG AEAKTVLPKK EKMKL
- 0.1 ml (also 25ul)
- Unconjugated
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Human
- SLX9 ribosome biogenesis factor
- C21orf70, FAM207A, PRED56
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
Specifications/Features
Available conjugates: Unconjugated